PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676710036
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family EIL
Protein Properties Length: 624aa    MW: 70861.7 Da    PI: 5.6578
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676710036genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3501.35e-153494211353
                XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
       EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekve 100
                +el++rmw+d+m+lkrlke+ k+    ke  ++a+k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipe+gkpv+gasd+Lr+WWk+kv+
  676710036  49 DELERRMWRDKMRLKRLKEQDKS----KEG-VDAAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPENGKPVTGASDNLREWWKDKVR 143
                79*******************98....777.9******************************************************************** PP

                XXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.-----GGG CS
       EIN3 101 fdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykkphd 200
                fdrngpaai+kyqa+n+i++ +++++     ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWP+Gke+ww++lgl+kdqg+ pykkphd
  676710036 144 FDRNGPAAITKYQAENNIPGVHEGNNP-IGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPNGKEDWWPQLGLPKDQGPAPYKKPHD 242
                ********************9999977.9*********************************************************************** PP

                --HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX...XXXXXXXXXXXXXXXXXXXX.XXXXXX.XXXX CS
       EIN3 201 lkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss...slrkqspkvtlsceqkedve.gkkeskikhvq 296
                lkkawkv+vLtavikhm p+i++ir+l+rqsk+lqdkm+akes+++l+++nqee+++++++++s    sl+ +s ++ +++ +++dve  +ke++  +v+
  676710036 243 LKKAWKVGVLTAVIKHMFPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEESLARELYPESCpplSLSGGSCSLLMNDCSQYDVEgFEKETH-YEVE 341
                ***************************************************************444579999****************5555555.7899 PP

                XXXXXX.........................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
       EIN3 297 avktta.........................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                + k ++                         + ++ rkrk +++ ++++  +  + tc+++ + +se + +f d+ns+++++
  676710036 342 ELKPEKvmnpsnfgmaakihdfpvkeevpsgNSEFLRKRKPNRDLNTIMDRT--VFTCENQGCAHSEISRGFLDRNSRDNHQ 421
                999888999******************************9655556665544..7*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048736.0E-12949296No hitNo description
Gene3DG3DSA:1.10.3180.107.8E-75170306IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.75E-60175299IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009873Biological Processethylene-activated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MMFNEMGMCG NMEFYSSGSL GEVDFCPAPQ AEPDSIVEDD YTDDEIDVDE LERRMWRDKM  60
RLKRLKEQDK SKEGVDAAKQ RQSQEQARRK KMSRAQDGIL KYMLKMMEVC KAQGFVYGII  120
PENGKPVTGA SDNLREWWKD KVRFDRNGPA AITKYQAENN IPGVHEGNNP IGPTPHTLQE  180
LQDTTLGSLL SALMQHCDPP QRRFPLEKGV PPPWWPNGKE DWWPQLGLPK DQGPAPYKKP  240
HDLKKAWKVG VLTAVIKHMF PDIAKIRKLV RQSKCLQDKM TAKESATWLA IINQEESLAR  300
ELYPESCPPL SLSGGSCSLL MNDCSQYDVE GFEKETHYEV EELKPEKVMN PSNFGMAAKI  360
HDFPVKEEVP SGNSEFLRKR KPNRDLNTIM DRTVFTCENQ GCAHSEISRG FLDRNSRDNH  420
QLGCPHRDSC LPYGAAAPSR FHVNEVKPVV GFSQPRPVNS VAQPIDLTGI GVPEDGQKMI  480
SDLMSMYDRN VQSNQASMVM ENQGVSLLQP TVQNHQEHLQ FQGNMVEGSF FEDLNIPNRA  540
NNNNNNNQTF FQSNNNNGFK YDTTHNNNFE AAHNNSSSNR FQLVFDSTPF DMASFDYRDD  600
MSMPGVVGTM DGMQQKQQDV SIWF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A3e-921743062134Protein ETHYLENE INSENSITIVE 3
4zds_B3e-921743062134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1376381LRKRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00367DAPTransfer from AT3G20770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0256290.0AB025629.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MOE17.
GenBankAF0042160.0AF004216.1 Arabidopsis thaliana ethylene-insensitive3 (EIN3) mRNA, complete cds.
GenBankAF0042170.0AF004217.1 Arabidopsis thaliana ethylene-insensitive3 (EIN3) gene, complete cds.
GenBankAY0698750.0AY069875.2 Arabidopsis thaliana AT3g20770/MOE17_6 mRNA, complete cds.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006297205.10.0hypothetical protein CARUB_v10013213mg
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLR0I1810.0R0I181_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.3__2304__AT3G20770.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21352879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein